Phodopus roborovskii (desert hamster): 127237709 Help Entry 127237709         CDS       T08852                                  Symbol Dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04145   Phagocytosis prob04814   Motor proteins prob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     127237709 (Dynlt1)   09142 Cell motility    04814 Motor proteins     127237709 (Dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127237709 (Dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:prob03037]     127237709 (Dynlt1)    04812 Cytoskeleton proteins [BR:prob04812]     127237709 (Dynlt1) Cilium and associated proteins [BR:prob03037]  Motile cilia and associated proteins   Dynein arm    127237709 (Dynlt1) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127237709 (Dynlt1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  127237709 NCBI-ProteinID:  XP_051062041 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagacttccaggcttccgaggagactgcatttgttgttgatgaagtgagcaacatt gtaaaggaggctatagaaagtgccattggtggcaatgcctaccagcacagcaaagtcaat cagtggaccacaaatgtcgtagagcagactctgagccaactcaccaagctggggaagcca tttaaatacattgtgacctgtgtgattatgcagaagaacggagctgggttacacactgca agttcctgcttctgggacagctccacggatgggagctgcacagtgcgatgggagaacaag accatgtactgtatagtcagtgccttcggactgtccatctga

DBGET integrated database retrieval system