Phodopus roborovskii (desert hamster): 30213875 Help Entry 30213875          CDS       T08852                                  Symbol BOP69_gp06 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism prob  Phodopus roborovskii (desert hamster) Pathway prob00190   Oxidative phosphorylation prob01100   Metabolic pathways prob04714   Thermogenesis prob04723   Retrograde endocannabinoid signaling prob05010   Alzheimer disease prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05016   Huntington disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05208   Chemical carcinogenesis - reactive oxygen species prob05415   Diabetic cardiomyopathy Module prob_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:prob00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     30213875 (BOP69_gp06)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     30213875 (BOP69_gp06)   09159 Environmental adaptation    04714 Thermogenesis     30213875 (BOP69_gp06)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     30213875 (BOP69_gp06)   09164 Neurodegenerative disease    05010 Alzheimer disease     30213875 (BOP69_gp06)    05012 Parkinson disease     30213875 (BOP69_gp06)    05014 Amyotrophic lateral sclerosis     30213875 (BOP69_gp06)    05016 Huntington disease     30213875 (BOP69_gp06)    05020 Prion disease     30213875 (BOP69_gp06)    05022 Pathways of neurodegeneration - multiple diseases     30213875 (BOP69_gp06)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     30213875 (BOP69_gp06)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:prob03029]     30213875 (BOP69_gp06) Enzymes [BR:prob01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      30213875 (BOP69_gp06) Mitochondrial biogenesis [BR:prob03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     30213875 (BOP69_gp06) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q4 DUF6341 Motif Other DBs NCBI-GeneID:  30213875 NCBI-ProteinID:  YP_009316443 UniProt:  A0A342Z5D2 LinkDB All DBs Position MT AA seq 115 aa AA seqDB search MNLMLTTITNITLSLTLITLAFWLPQLNIYTEKASPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAMQTTNLILTLIMAFSFLTILALGLAYEWKQKGLEWTE NT seq 348 nt NT seq  +upstreamnt  +downstreamnt ataaacttgatattaaccactattacaaacattaccctatccctcacattaattacacta gccttctgactaccccaacttaatatctacacagaaaaagcaagcccctatgaatgcggg tttgacccaataagctcagcccgacttcctttctctataaaattttttcttgtagcaatc acttttctcctatttgacctagaaattgccctactcctcccactaccctgagccatgcaa acaacaaacttaattctaaccctaattatagccttctcgttcctaaccatcctagcacta ggactagcctatgagtgaaaacaaaagggcctagaatgaactgaataa

DBGET integrated database retrieval system