KEGG   Prosthecochloris sp. CIB 2401: Ptc2401_00279
Entry
Ptc2401_00279     CDS       T04424                                 
Symbol
spo0F_1
Name
(GenBank) Sporulation initiation phosphotransferase F
Organism
proc  Prosthecochloris sp. CIB 2401
SSDB
Motif
Pfam: Response_reg FleQ
Other DBs
NCBI-ProteinID: ANT64082
LinkDB
Position
complement(284228..284587)
AA seq 119 aa
MKILVIDDDDAVRKFITEILRQDGYSVTGAENGKIALQVLAQQPDIMFVITDIIMPEQEG
IETIREIKACYPRIKIIAISGGGKISPENYLQLAHAMGANTTLSKPFSRKELLDALLYI
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaaatccttgtcatagatgacgatgatgcagtacggaaattcataaccgaaatcctc
aggcaggacggttattcggtgacaggtgccgaaaacggcaagatagcactgcaggtactg
gctcaacagcctgatatcatgtttgtcataactgacatcatcatgccggaacaggaaggc
attgaaacaatcagggaaatcaaagcctgttatcccagaatcaagatcattgccatatct
ggaggaggaaaaatcagtccggaaaattacctgcaactagcccatgcaatgggagccaat
acgacactgagcaagccattttccagaaaggaactgctcgatgccctattgtatatctga

DBGET integrated database retrieval system