Prodigiosinella aquatilis: PCO85_08025 Help Entry PCO85_08025       CDS       T09220                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prod  Prodigiosinella aquatilis Pathway prod00998   Biosynthesis of various antibiotics prod01100   Metabolic pathways prod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCO85_08025    00074 Mycolic acid biosynthesis     PCO85_08025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCO85_08025 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WJV55335 LinkDB All DBs Position complement(1730653..1730922) Genome browser AA seq 89 aa AA seqDB search MKTPELADIVALLAETGDQDDSVQAELTVSEADKSLEELGFDSLALFNFAILVDKKYGVH LSFDELMGYSTITSLFEAIHHVYISKIQG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaagactccagaactcgctgatattgtagcacttcttgcagaaacgggtgaccaggat gatagcgtccaggccgagttaacagtgagtgaagctgacaaaagtcttgaagaattgggc ttcgattcccttgcgctgtttaacttcgccattttagttgacaaaaaatatggcgtgcat ctttcgtttgacgagctgatgggctatagcaccataaccagtctctttgaagctattcat catgtttacatcagcaaaatacaggggtaa

DBGET integrated database retrieval system