Prosthecochloris sp. SCSIO W1103: OO005_00820 Help Entry OO005_00820       CDS       T09697                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism proi  Prosthecochloris sp. SCSIO W1103 Pathway proi01100   Metabolic pathways proi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:proi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OO005_00820 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OO005_00820 (acpP) BRITE hierarchy Motif Pfam:  PP-binding PP-binding_2 DUF1493 CdvA Ribosomal_L50 ThermoDBP-RP_arch HLH Motif Other DBs NCBI-ProteinID:  UZJ37774 UniProt:  A0A9E8J535 LinkDB All DBs Position complement(168023..168256) Genome browser AA seq 77 aa AA seqDB search MSAEIKDKVYDIIVSKMGVNKDQIKLESKFADDLGADSLDTVELIMELENEFDIQIPDED AEKISTVQQAIDYIVNK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgcggaaatcaaagacaaagtttacgacattatcgtaagcaaaatgggtgtcaac aaagatcagatcaaacttgaatcaaagtttgccgacgatctgggagctgattcacttgac actgttgagctgatcatggagcttgaaaatgaatttgacattcagattcctgatgaagat gcagaaaaaatcagcactgtacagcaggcaatcgactacatcgtcaacaagtga

DBGET integrated database retrieval system