Proteiniclasticum sp. QWL-01: P6M73_07330 Help Entry P6M73_07330       CDS       T08970                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism proq  Proteiniclasticum sp. QWL-01 Pathway proq01100   Metabolic pathways proq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:proq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P6M73_07330 (acpP)    00074 Mycolic acid biosynthesis     P6M73_07330 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P6M73_07330 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 zf-DNL Motif Other DBs NCBI-ProteinID:  WFF74252 LinkDB All DBs Position 1517146..1517379 Genome browser AA seq 77 aa AA seqDB search MVFDKVKHIIADKLGISEGEIKMETTFEDLGADSLDIVELIMAIEEEYDIQVSDEEAERA QSVGDVVNYINTLVGEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggtatttgacaaagtaaaacacatcatcgccgataagctgggaatcagcgagggcgag atcaaaatggagacgacctttgaagatttaggggcagattccctcgacatcgtcgaactg attatggccattgaagaggaatatgatatccaggtatccgacgaggaagctgaaagagct cagtcggtaggcgatgtagtcaactacatcaatacactggttggcgaagaataa

DBGET integrated database retrieval system