Proteiniclasticum sp. QWL-01: P6M73_14825 Help Entry P6M73_14825       CDS       T08970                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism proq  Proteiniclasticum sp. QWL-01 Brite KEGG Orthology (KO) [BR:proq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:proq03032]     P6M73_14825    03036 Chromosome and associated proteins [BR:proq03036]     P6M73_14825    03400 DNA repair and recombination proteins [BR:proq03400]     P6M73_14825 DNA replication proteins [BR:proq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     P6M73_14825 Chromosome and associated proteins [BR:proq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     P6M73_14825 DNA repair and recombination proteins [BR:proq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       P6M73_14825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  WFF72530 LinkDB All DBs Position complement(3236055..3236360) Genome browser AA seq 101 aa AA seqDB search MNKAELITKIAESGKMTKKEAEVALNAFKEAVMGALEAGDKVQLVGFGTFEVRERAAREG RNPRTKETIQIPASKVPVFKPGKDFKGLVNKPVPKKKSKKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagcggaattaatcaccaaaatcgcagaatccggcaagatgaccaagaaagaa gctgaagttgcattaaacgctttcaaggaagccgttatgggtgcgcttgaagctggtgac aaagttcaactcgttggctttggaactttcgaagtcagagaaagagctgccagagaagga agaaaccccagaaccaaggaaaccattcagattccggcatcgaaagttcccgtgttcaaa ccgggcaaagacttcaagggcttagtcaacaaaccggtcccgaagaagaaatccaaaaag aaatag

DBGET integrated database retrieval system