Prosthecochloris sp. GSB1: CHL67_00855 Help Entry CHL67_00855       CDS       T04996                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pros  Prosthecochloris sp. GSB1 Pathway pros01100   Metabolic pathways pros01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pros00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHL67_00855    00074 Mycolic acid biosynthesis     CHL67_00855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHL67_00855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  ASQ89662 UniProt:  A0A222SG33 LinkDB All DBs Position complement(174062..174298) Genome browser AA seq 78 aa AA seqDB search MSAEEIKDKVYDIIVSKMGVNKDQIKMESKFADDLGADSLDTVELIMELENEFDIQIPDE DAEKISTVQQAIDYIAKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgaagaaattaaagacaaggtatacgacatcatcgtcagcaaaatgggcgtc aacaaggaccagatcaagatggaatcgaagtttgccgatgatcttggcgccgactctctc gacaccgtcgagctgatcatggaactcgaaaacgagttcgacatccagattcccgatgaa gacgccgaaaaaatcagcaccgtccagcaggcgatcgactacatcgccaagaagtaa

DBGET integrated database retrieval system