Prosthecochloris sp. GSB1: CHL67_01510 Help Entry CHL67_01510       CDS       T04996                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pros  Prosthecochloris sp. GSB1 Brite KEGG Orthology (KO) [BR:pros00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pros03032]     CHL67_01510    03036 Chromosome and associated proteins [BR:pros03036]     CHL67_01510    03400 DNA repair and recombination proteins [BR:pros03400]     CHL67_01510 DNA replication proteins [BR:pros03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CHL67_01510 Chromosome and associated proteins [BR:pros03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CHL67_01510 DNA repair and recombination proteins [BR:pros03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CHL67_01510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 DUF937 Motif Other DBs NCBI-ProteinID:  ASQ89770 UniProt:  A0A222SG28 LinkDB All DBs Position 305576..305848 Genome browser AA seq 90 aa AA seqDB search MSKAELVEKIASQAGLTKADAERAVNAFVTVVTAGLKAGEDVTLVGFGTFATGDRAARQG RNPQTGETITIAAKKVVKFKPGKALRDEVA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagccgagttagtagagaaaattgcttcacaggcagggttgacgaaagccgat gcggaaagagcggtcaacgcgtttgtcacggttgtcacggcaggccttaaagctggagaa gacgttactctcgtagggtttggaacgttcgcgacaggagacagagccgcgcgacagggc cgtaacccccagactggcgagaccattaccatcgcggccaaaaaagtcgtcaaattcaag cccggcaaagcgttaagggatgaggttgcctga

DBGET integrated database retrieval system