Proteus sp. CD3: BTA34_13035 Help Entry BTA34_13035       CDS       T06244                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism prot  Proteus sp. CD3 Brite KEGG Orthology (KO) [BR:prot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prot03036]     BTA34_13035 Chromosome and associated proteins [BR:prot03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BTA34_13035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB DUF3450 DUF4131 Motif Other DBs NCBI-ProteinID:  QEZ93204 LinkDB All DBs Position complement(2899633..2899923) Genome browser AA seq 96 aa AA seqDB search MGKLTVLLLILLGWLQYSLWLGKNGIHDYNKVTQEVESALAQNTQLKERNDRLFAEIDDL NGGQEALEERARSELGMIKPNETFFRIVSDKSQPRR NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggggaaattaacagtcttacttctgattttacttggttggctacaatattcattgtgg ttaggtaaaaatggtatccatgattacaacaaagtaactcaagaagttgaatctgcattg gcgcaaaatacgcagttaaaagagcgtaatgatcgtctatttgcagagattgatgacctc aatggcgggcaagaagcgttagaagaacgcgctcgtagtgagttaggaatgataaagcct aatgagacatttttccgaattgtgagcgataaatctcaaccacgtcgttaa

DBGET integrated database retrieval system