Prosthecochloris sp. SCSIO W1101: OO006_12725 Help Entry OO006_12725       CDS       T09696                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism prow  Prosthecochloris sp. SCSIO W1101 Brite KEGG Orthology (KO) [BR:prow00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:prow03032]     OO006_12725    03036 Chromosome and associated proteins [BR:prow03036]     OO006_12725    03400 DNA repair and recombination proteins [BR:prow03400]     OO006_12725 DNA replication proteins [BR:prow03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OO006_12725 Chromosome and associated proteins [BR:prow03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OO006_12725 DNA repair and recombination proteins [BR:prow03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OO006_12725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Spiralin DUF2267 Motif Other DBs NCBI-ProteinID:  UZJ41193 LinkDB All DBs Position complement(2739609..2739881) Genome browser AA seq 90 aa AA seqDB search MSKAELVEKIASQAGLTKADAERAVNAFVNVVTAGLKAGDDITLVGFGTFSTGERAERQG RNPQTGETITIAAKKVVKFKPGKALKEEVA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtctaaagctgagttagttgaaaagatcgcatcccaggcagggttaaccaaagccgac gcggaaagggctgtgaacgcctttgtgaatgttgtgacagctggtcttaaagcaggtgat gatatcacgcttgttggtttcgggactttttccacaggtgaaagagccgaacggcaggga cgaaaccctcagacaggcgagacaattaccatcgcagcgaaaaaagttgtgaagttcaag cctggtaaggcattgaaagaagaggtggcctga

DBGET integrated database retrieval system