Pseudoalteromonas rubra: AT705_00950 Help Entry AT705_00950       CDS       T04179                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism prr  Pseudoalteromonas rubra Brite KEGG Orthology (KO) [BR:prr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:prr03032]     AT705_00950    03036 Chromosome and associated proteins [BR:prr03036]     AT705_00950    03400 DNA repair and recombination proteins [BR:prr03400]     AT705_00950 DNA replication proteins [BR:prr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AT705_00950 Chromosome and associated proteins [BR:prr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AT705_00950 DNA repair and recombination proteins [BR:prr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AT705_00950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ALU44953 UniProt:  A0A0L0EXA2 LinkDB All DBs Position 1:207018..207296 Genome browser AA seq 92 aa AA seqDB search MNKSELVTAMAAHSELTKKDTQAALGSLIKLITKRLSEGDQVQLNGMGTFTLSYHPAKPG RNPRTGEEIMIEGQNKVLFKPAKALKDALADK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataaaagtgaactggttacagccatggcggcgcacagtgaattgaccaagaaagac acacaggctgcactgggtagtcttataaaacttatcaccaaacgtctctctgaaggagat caggttcaacttaatggtatgggcacctttacgctgagctatcatccggccaagccgggc agaaaccccagaacaggggaagagatcatgatcgaagggcagaataaagtgctgtttaag ccagccaaagcgctcaaggacgctctggctgacaaatag

DBGET integrated database retrieval system