Pseudoalteromonas rubra: AT705_05480 Help Entry AT705_05480       CDS       T04179                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prr  Pseudoalteromonas rubra Pathway prr01100   Metabolic pathways prr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AT705_05480    00074 Mycolic acid biosynthesis     AT705_05480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AT705_05480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  ALU42447 UniProt:  A0A0F4QI99 LinkDB All DBs Position 1:complement(1236322..1236558) Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIVEQLGVKEEEVKSEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatccaagaacgcgtaaaaaaaatcatcgttgagcaactaggtgttaaagaa gaagaagtaaaatcagaagcgtctttcgtagacgatctgggtgctgattctcttgacact gttgagctggtaatggctcttgaagaagagttcgacactgagattcctgacgaagaagct gagaaaatcactactgttcaggcagcgatcgactacgttactgctcacgctgagtaa

DBGET integrated database retrieval system