KEGG   Pseudoalteromonas rubra: AT705_06640
Entry
AT705_06640       CDS       T04179                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00333  Prodigiosin biosynthesis
prr01100  Metabolic pathways
prr01110  Biosynthesis of secondary metabolites
Module
prr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AT705_06640
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: ALU42660
UniProt: A0A0U2X372
LinkDB
Position
1:1496111..1497196
AA seq 361 aa
MTHTAFEQTLAEAVALARLAPSSHNCQPWAVHFDPVIHCGYLAIDNRRKLTGLPSLEREM
LLSCGIFFHFLEQLIYLRGYQLHWRWCDEQEQQVLAGEDRALIRFMPGPEQAHQATAFAT
LSEQLQQRHTVRSAYRSTLLSEQQRNELSTVLKPYPVTLGIYYQQTHGKALAHLTQTYAG
LDFANKAAWRETYSYIRFDERRQYEDGFYLHNLFGPVSGGFKTFFKVAFHPHLSGLNKLL
RLPTKMAQGLAELVETGPHYLALNVSKEGDEALFRAGLGLGALWLKLQQWGWAMHPISVL
VQHDSAREALATSLSQSELPIFFARFGEPEQSGSPAPRRHWQSILVSDTHSLTKSTPTQR
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgacacacactgcatttgaacaaacactggcagaggctgtcgcactggcacggcttgcg
ccgtcttcacacaactgtcagccctgggccgttcacttcgatcccgtgatccactgtggc
tacctggccatagacaaccgccgtaaactgaccggcctgccgtcattagaacgggaaatg
ctgctcagctgtggtattttcttccactttcttgagcaactaatatacctgcgcgggtat
cagctgcactggcgctggtgcgatgagcaagagcaacaagtattggccggcgaagaccga
gcacttatccgttttatgccgggaccggagcaggcgcaccaggcaaccgcatttgcgact
ttgtctgagcagctccaacaacgccatacggtacgttcagcgtaccgtagcacactgctc
agtgagcaacagcgtaacgagctgagcacggtgctcaaaccttacccggtgacgcttggg
atatattaccagcagacgcatggcaaagcgctggctcacctgacacaaacttatgccggc
ctggattttgccaacaaagccgcatggcgcgaaacctatagctatattcgctttgatgaa
cggcgccagtacgaagatgggttttaccttcacaacctatttggcccggtttctggcggt
ttcaaaaccttttttaaagtcgcctttcatcctcacctgagtggtctgaataaattgctc
agattgccaaccaaaatggcccagggccttgctgagctggttgaaaccgggccgcactac
ctggcgctgaatgtcagtaaagaaggcgatgaagccctttttcgtgctggcttagggcta
ggtgctttatggctcaaactacagcagtggggatgggcaatgcacccaatcagtgtactt
gtgcaacacgattctgccagagaggccttagcaaccagcctcagtcagtctgagttaccc
atttttttcgcccgattcggcgaacccgagcaatccggtagcccggcaccaaggcggcac
tggcagagcattctggtctcagacacccacagtctgactaagtccacgccgactcaacgt
gagtaa

DBGET integrated database retrieval system