Pseudoalteromonas rubra: AT705_10560 Help Entry AT705_10560       CDS       T04179                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism prr  Pseudoalteromonas rubra Pathway prr00290   Valine, leucine and isoleucine biosynthesis prr00650   Butanoate metabolism prr00660   C5-Branched dibasic acid metabolism prr00770   Pantothenate and CoA biosynthesis prr01100   Metabolic pathways prr01110   Biosynthesis of secondary metabolites prr01210   2-Oxocarboxylic acid metabolism prr01230   Biosynthesis of amino acids Module prr_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine prr_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:prr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     AT705_10560    00660 C5-Branched dibasic acid metabolism     AT705_10560   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     AT705_10560   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AT705_10560 Enzymes [BR:prr01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      AT705_10560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 LPD7 Motif Other DBs NCBI-ProteinID:  ALU43345 UniProt:  A0A0F4QIF7 LinkDB All DBs Position 1:complement(2387991..2388230) Genome browser AA seq 79 aa AA seqDB search MKHQLTVAVNNQAIAVERFLRVARHRGFRLTQLELQGHEELFHVKMTVDSDKPIYLLTSQ LNKLVEVQSVDLHTLQQAI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaacatcaactcaccgtagcggtaaacaatcaagccatcgcagtcgagcgtttttta cgcgtcgcccgtcatcgcgggtttcgcctgacgcaactggagctccagggccacgaagag ttatttcacgtcaaaatgacagtagatagtgacaaacctatctatctattgacgtcacaa ttaaataagcttgttgaagtgcaatcagtcgatctgcacacactacagcaggcaatataa

DBGET integrated database retrieval system