Pseudoalteromonas rubra: AT705_23115 Help Entry AT705_23115       CDS       T04179                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism prr  Pseudoalteromonas rubra Pathway prr01100   Metabolic pathways prr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AT705_23115    00074 Mycolic acid biosynthesis     AT705_23115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AT705_23115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALU45821 UniProt:  A0A0U2PFJ5 LinkDB All DBs Position 2:937993..938271 Genome browser AA seq 92 aa AA seqDB search MKSEIENLPFYRVLCEAIENVQAESLSVFTSLESEDDLHNMSIQRLGLDSVQIFELVGNI EDIFSITLSDTQVFECKTLGELRSLCEENGVC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaagcgaaattgaaaatctacctttttatcgggttttatgtgaagccattgaaaat gtacaggcagagtcattaagtgtattcacgtctttagaaagtgaagacgatcttcataat atgagtattcaacggctcggattagattcagtacaaatatttgaattggttggcaacatt gaagatattttttccatcactctgtcggatacccaggtatttgagtgcaaaactctggga gagttaaggtcactgtgtgaagaaaatggggtttgctaa

DBGET integrated database retrieval system