Planococcus rifietoensis: AUC31_00650 Help Entry AUC31_00650       CDS       T04201                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism prt  Planococcus rifietoensis Brite KEGG Orthology (KO) [BR:prt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:prt03032]     AUC31_00650    03036 Chromosome and associated proteins [BR:prt03036]     AUC31_00650    03400 DNA repair and recombination proteins [BR:prt03400]     AUC31_00650 DNA replication proteins [BR:prt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AUC31_00650 Chromosome and associated proteins [BR:prt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AUC31_00650 DNA repair and recombination proteins [BR:prt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AUC31_00650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Rpf1_C Motif Other DBs NCBI-ProteinID:  ALS73849 UniProt:  A0A0U2N2R3 LinkDB All DBs Position complement(1603919..1604191) Genome browser AA seq 90 aa AA seqDB search MNKTELVNSVAEAAELSRKDAAKAVDAAFEAIQDALTKGDKVQLIGFGNFEVRERAARKG RNPQTGAEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtgaactctgttgcagaagcggctgaactttctcgtaaagat gctgcgaaagcagttgacgctgcatttgaagcgattcaagatgctctaactaaaggtgac aaagtacaattgatcggattcggtaactttgaagttcgtgagcgcgcggcccgtaaagga cgcaacccacaaacaggtgctgaaatcgagatcgccgcaagcaaggttcctgcctttaag ccaggtaaagcacttaaagacgcagtgaaataa

DBGET integrated database retrieval system