Pendulispora rubella: LVJ94_05815 Help Entry LVJ94_05815       CDS       T10973                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism prue  Pendulispora rubella Pathway prue00261   Monobactam biosynthesis prue01100   Metabolic pathways prue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prue00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LVJ94_05815  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:prue01008]     LVJ94_05815 Polyketide biosynthesis proteins [BR:prue01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LVJ94_05815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WXB06750 UniProt:  A0ABZ2LC46 LinkDB All DBs Position complement(1388580..1388795) Genome browser AA seq 71 aa AA seqDB search MSEEHDDTTTYKVVVNHEEQYSIWPEYRDNPLGWRDAGKSGSKAECLDHIAQVWTDMRPL SLRNQMEGKTP NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagaacacgacgacacgacgacgtacaaagtggtggtcaaccacgaggagcag tattcgatctggccggagtaccgcgacaatcctctgggctggcgcgatgcgggcaagagc ggctcgaaggccgaatgcctagatcacatcgcccaggtttggaccgacatgcggcccctc agcctgcgcaaccagatggaaggcaagacgccgtga

DBGET integrated database retrieval system