Pendulispora rubella: LVJ94_12750 Help Entry LVJ94_12750       CDS       T10973                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prue  Pendulispora rubella Pathway prue00998   Biosynthesis of various antibiotics prue01100   Metabolic pathways prue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ94_12750 (acpP)    00074 Mycolic acid biosynthesis     LVJ94_12750 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ94_12750 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WXB08098 LinkDB All DBs Position complement(3165440..3165685) Genome browser AA seq 81 aa AA seqDB search MAHDIPAEVKRIIKEQLDVDEKDIKPESTFIDDLGADSLGLVELVLAFEEAFEIDIPDED TEKIRTVQDAIDYIEKHAKKS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctcacgacatccccgccgaggtcaaacgcatcatcaaagagcagctcgatgtcgac gaaaaagacatcaagccggaatcgacgttcatcgacgacctcggggccgactccctcggc ctggtcgagctggtgctcgctttcgaagaagctttcgagatcgacattccggacgaggac accgagaagatccgcacggtgcaggacgccatcgactacatcgagaagcacgcgaagaag tcgtaa

DBGET integrated database retrieval system