Pendulispora rubella: LVJ94_41855 Help Entry LVJ94_41855       CDS       T10973                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism prue  Pendulispora rubella Pathway prue00253   Tetracycline biosynthesis prue01056   Biosynthesis of type II polyketide backbone prue01100   Metabolic pathways prue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prue00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     LVJ94_41855    00253 Tetracycline biosynthesis     LVJ94_41855  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:prue01004]     LVJ94_41855    01008 Polyketide biosynthesis proteins [BR:prue01008]     LVJ94_41855 Lipid biosynthesis proteins [BR:prue01004]  Polyketide synthase   Component type    LVJ94_41855 Polyketide biosynthesis proteins [BR:prue01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      LVJ94_41855     Nonaketide PKS      LVJ94_41855     Decaketide PKS      LVJ94_41855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WXB03438 UniProt:  A0ABZ2KXW9 LinkDB All DBs Position complement(10819734..10820015) Genome browser AA seq 93 aa AA seqDB search MTKEFTLEDLKRVLLASAGAAEGVDLDSNILDIDFADLGYESVALLETGRQIELECRVSL DDGALAQVRTPRALLSLVNGHRNAANAQLREAS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagaattcaccctcgaagatctcaagcgggtccttctagctagcgccggagcg gcggagggcgtcgacctggacagcaatatcctcgacatcgactttgcagacttgggctac gaatcggtggccctgctcgaaacgggccggcagatcgagctcgaatgccgcgtctccctc gacgatggcgcgctcgcgcaggtccgcacgccccgcgccctgctgtctttggtgaacggc caccgcaacgccgccaacgcccagctccgcgaggcatcatga

DBGET integrated database retrieval system