Planktothrix rubescens: PCC7821_03943 Help Entry PCC7821_03943     CDS       T09709                                  Symbol psbF Name (GenBank) Cytochrome b559 subunit beta   KO K02708   photosystem II cytochrome b559 subunit beta Organism prun  Planktothrix rubescens Pathway prun00195   Photosynthesis prun01100   Metabolic pathways Module prun_M00161   Photosystem II prun_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:prun00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     PCC7821_03943 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:prun00194]     PCC7821_03943 (psbF) Photosynthesis proteins [BR:prun00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     PCC7821_03943 (psbF) BRITE hierarchy Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  CAD5973429 LinkDB All DBs Position I:complement(4323937..4324074) Genome browser AA seq 45 aa AA seqDB search MATGGSSNEPISYPIFSVRWLAIHTLAVPTVFFLGAIAAMQFIQR NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atggcaacgggtggcagttccaatgaacccataagttatccgatttttagtgttcgttgg ttagcaattcatactttagcagtacctacggtttttttcttaggtgcgatcgcggctatg caatttattcaacgatag

DBGET integrated database retrieval system