Propioniciclava coleopterorum: G7070_12350 Help Entry G7070_12350       CDS       T06483                                  Name (GenBank) glycerate kinase   KO K03637   cyclic pyranopterin monophosphate synthase [EC:4.6.1.17] Organism prv  Propioniciclava coleopterorum Pathway prv00790   Folate biosynthesis prv01100   Metabolic pathways prv01240   Biosynthesis of cofactors prv04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:prv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     G7070_12350  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     G7070_12350 Enzymes [BR:prv01000]  4. Lyases   4.6  Phosphorus-oxygen lyases    4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)     4.6.1.17  cyclic pyranopterin monophosphate synthase      G7070_12350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gly_kinase Motif Other DBs NCBI-ProteinID:  QIK73954 UniProt:  A0A6G7YAM8 LinkDB All DBs Position 2589011..2589307 Genome browser AA seq 98 aa AA seqDB search MCAETAQFERTAAAADVLVTGADQLDFVRRGGPVVGEVIAAAERTLRPCVVVARTVDVSA RELRTFGVEVAYAVGGEPDLGADALTTRAAGVAGSWTW NT seq 297 nt NT seq  +upstreamnt  +downstreamnt ctgtgcgccgagacggcgcagttcgagaggacggccgccgccgccgacgtcctcgtgacc ggggccgaccagctcgacttcgtccggcgcggcggccccgtcgtgggcgaggtgatcgcc gccgccgagcggaccctgcggccgtgcgtggtggtcgccaggaccgtcgacgtgtcggcg cgcgagctccggaccttcggcgtcgaggtggcctacgcggtgggcggggagcccgacctg ggcgccgacgccctcacgacccgcgccgcgggcgtggcgggcagctggacgtggtga

DBGET integrated database retrieval system