Pseudomonas rhodesiae: HRH33_02605 Help Entry HRH33_02605       CDS       T07097                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism prx  Pseudomonas rhodesiae Brite KEGG Orthology (KO) [BR:prx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:prx03110]     HRH33_02605 (grxC) Chaperones and folding catalysts [BR:prx03110]  Protein folding catalysts   Protein disulfide isomerase    HRH33_02605 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Glrx-like GST_N DSBA Thioredoxin CLIC-like_N SH3BGR Motif Other DBs NCBI-ProteinID:  QKJ71500 LinkDB All DBs Position 604085..604339 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDWCPYCMRAKALLEKKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGT RHVGGCDDLFALERAGKLDALLSA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggtcgtcgtatattccagcgattggtgcccgtactgcatgcgggccaaggcc ctgcttgagaagaagggcgttgcgttcgaagagatcaaggtcgacggcaagccccaggtg cgtgccgaaatggcccagaaagcggggcgtacgtccgtgccgcagatctggatcggcacc cggcacgtcggtggttgcgatgacctgtttgctttggagcgcgccggtaaactcgatgcg ctgctgtccgcctga

DBGET integrated database retrieval system