Pseudomonas rhodesiae: HRH33_03120 Help Entry HRH33_03120       CDS       T07097                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prx  Pseudomonas rhodesiae Pathway prx01100   Metabolic pathways prx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HRH33_03120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HRH33_03120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKJ71599 LinkDB All DBs Position complement(722067..722336) Genome browser AA seq 89 aa AA seqDB search MSDKQRLEHDIKTLIIEALGLEDIGAEDIPSDQILFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaaacaacgccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcggcgcggaagatatccccagcgaccagatcctgttcggcgaaggcttg ggcctggattcggtggacgccctggaactgggcctggccatccagaaaaagtacggcatc aagatcgatgccgacgccaaggacactcgcaaccacttcaccaacgtggccagccttgcg gcgttcgtcacggcccgccaggcagcttga

DBGET integrated database retrieval system