Pseudomonas rhodesiae: HRH33_15795 Help Entry HRH33_15795       CDS       T07097                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prx  Pseudomonas rhodesiae Pathway prx01100   Metabolic pathways prx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HRH33_15795 (acpP)    00074 Mycolic acid biosynthesis     HRH33_15795 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HRH33_15795 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF5783 DUF1896 MAP Motif Other DBs NCBI-ProteinID:  QKJ73976 LinkDB All DBs Position complement(3527904..3528143) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGIAEADVKNGSSFVDDLGADSLDTVELVMALEDEFEIEIPDEEA EKITQVQLAIDYATAHAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgaacagcgagtgaaaaaaatcgtcgccgaacagctaggcattgctgaa gccgacgtcaagaacgggagttctttcgtggacgatttgggcgccgattccttggacacg gtggaactggtgatggccctggaagacgagttcgaaattgaaattccggacgaggaggcc gagaaaatcacccaggtccaattggccattgattacgcgacggcgcacgcaaagtcatag

DBGET integrated database retrieval system