KEGG   Polymorphospora rubra: Prubr_36380
Entry
Prubr_36380       CDS       T07190                                 
Name
(GenBank) hypothetical protein
Organism
pry  Polymorphospora rubra
SSDB
Motif
Pfam: HTH_18 HTH_AraC HTH_23 HTH_Tnp_ISL3 HTH_IclR HTH_28 HTH_17 AbiEi_4 DprA_WH HTH_29 HTH_PafC DUF6597
Other DBs
NCBI-ProteinID: BCJ66617
UniProt: A0A810MZQ5
LinkDB
Position
complement(3868285..3868839)
AA seq 184 aa
MKFRPGGFAPFLVGPVARLTGQTRPLAEFWGGADAAGLARDLAAAGPDLGALVAVAEHHL
RAHRPAPDPEVERVGRIVRTLLHDRSVLRVDEVAARFGLSPRSLQRLFQRYVGVSPKWIL
RRYRLHEAAARLAADDGPANWSEVAADLGYFDQSHFIRDFAAAVGMTPAAYADACRRRVQ
PVSA
NT seq 555 nt   +upstreamnt  +downstreamnt
gtgaagttccggccgggcgggttcgcgccgttcctggtcgggccggtggcccggctcacc
ggccagacccggccgctcgccgaattctggggcggggccgacgccgccgggttggcccgt
gacctggccgccgccggcccggacctcggcgcgctggtcgcggtcgcggagcaccacctc
cgggcgcaccggccggcgccggaccccgaggtggaacgggtcgggcggatcgtacgcaca
ctgctgcacgaccggtcggtgctccgggtcgacgaggtggcggcccggttcggcctgtcg
ccccggtcgctgcaacggctcttccagcgttacgtcggcgtgagtccgaagtggatactt
cggcgctaccggctgcacgaggcggccgcccggctggcggcggacgacgggccggccaac
tggagcgaggtcgccgccgacctgggctatttcgaccagtcgcacttcatccgggacttc
gccgcggcggtggggatgaccccggccgcgtacgccgacgcctgtcgccgccgcgtccag
ccggtgagcgcctga

DBGET integrated database retrieval system