Polymorphospora rubra: Prubr_44620 Help Entry Prubr_44620       CDS       T07190                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pry  Polymorphospora rubra Pathway pry00998   Biosynthesis of various antibiotics pry01100   Metabolic pathways pry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Prubr_44620    00074 Mycolic acid biosynthesis     Prubr_44620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Prubr_44620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BCJ67441 UniProt:  A0A810N1F5 LinkDB All DBs Position 4847035..4847274 Genome browser AA seq 79 aa AA seqDB search MDNGFPGLLKPFLKYAGTQPINPEASLNDLGLDSMRAIELLFAIEDTYGVSMPDELLTDA TFATAGSLWATIEALRGPR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtggacaatggatttccgggcctgctcaagcccttcctcaagtacgccggaacgcaaccc atcaacccggaggcgtccctcaacgacctgggcctcgactcgatgcgcgcgatcgagctg ctgttcgccatcgaggacacgtacggggtgtccatgccggacgaactgctgaccgacgcg acgttcgcgaccgccggcagcctctgggcgacgatcgaggcactgcgggggccgagatga

DBGET integrated database retrieval system