KEGG   Paenibacillus rhizovicinus: GZH47_18140
Entry
GZH47_18140       CDS       T06983                                 
Name
(GenBank) F0F1 ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
prz  Paenibacillus rhizovicinus
Pathway
prz00190  Oxidative phosphorylation
prz01100  Metabolic pathways
Module
prz_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:prz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GZH47_18140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:prz00194]
    GZH47_18140
Photosynthesis proteins [BR:prz00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   GZH47_18140
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Other DBs
NCBI-ProteinID: QHW32542
UniProt: A0A6C0P7P5
LinkDB
Position
4032311..4032709
AA seq 132 aa
MSSFLLEIVTPERKVYAEDVNMVIVKGSEGEMGIMPNHIPMVTPLKIAPITVKKKNTEEK
IAVGGGFLEIRKDKVVILAESAELPGDIDLARAEAAKQRAEQRLGGKSDYDQLRAELALQ
RAMNRIAVKSNG
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagctcctttttactggaaattgtaacgcctgagcgtaaagtttacgctgaggatgta
aatatggtcatcgtcaaaggctctgagggcgagatgggcattatgcctaatcatatcccg
atggtcacgcctttgaagattgctcccattacggtcaagaagaagaacacggaagagaaa
atcgccgttggcggcggttttctcgaaatccgcaaggataaagtggtcattctggccgag
agcgctgaactgcctggcgatatcgacctcgcccgcgcagaagcagcgaagcaacgtgcg
gagcaacgtctaggtggcaagagcgattacgatcaacttcgcgccgagcttgctctgcag
cgcgctatgaaccggatcgccgtaaaatcgaacggctaa

DBGET integrated database retrieval system