Stutzerimonas stutzeri A1501: PST_2621 Help Entry PST_2621          CDS       T00511                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psa  Stutzerimonas stutzeri A1501 Pathway psa01100   Metabolic pathways psa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PST_2621 (acpP)    00074 Mycolic acid biosynthesis     PST_2621 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PST_2621 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  ABP80271 UniProt:  A4VMS0 LinkDB All DBs Position complement(2840851..2841087) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system