Stutzerimonas stutzeri A1501: PST_3146 Help Entry PST_3146          CDS       T00511                                  Symbol groES Name (GenBank) chaperonin, 10 kDa   KO K04078   chaperonin GroES Organism psa  Stutzerimonas stutzeri A1501 Brite KEGG Orthology (KO) [BR:psa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psa03110]     PST_3146 (groES)    03029 Mitochondrial biogenesis [BR:psa03029]     PST_3146 (groES) Chaperones and folding catalysts [BR:psa03110]  Heat shock proteins   HSP10    PST_3146 (groES) Mitochondrial biogenesis [BR:psa03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PST_3146 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  ABP80784 UniProt:  A4VP83 LinkDB All DBs Position complement(3389525..3389818) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRAPAVK VGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVIEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtcgtgattcgtcgcagcgaagaagaaaccaag accgcaggcggcatcgtcctgccgggctccgctgccgagaaaccgaaccgtggcgaagtc gttgctgtcggtaccggacgtgtgctggacaacggcgaagtgcgcgctccggccgttaag gtcggcgacaaggtggtgttcggcccgtactccggcagcaacaccgtcaaggtcgacggc gaagacctgctggtgatgagcgagaacgaaatcctcgccgtcatcgaagcctga

DBGET integrated database retrieval system