Paraburkholderia sabiae: QEN71_03815 Help Entry QEN71_03815       CDS       T09203                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psaa  Paraburkholderia sabiae Pathway psaa00998   Biosynthesis of various antibiotics psaa01100   Metabolic pathways psaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QEN71_03815    00074 Mycolic acid biosynthesis     QEN71_03815   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QEN71_03815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB CagD Raf1_N Motif Other DBs NCBI-ProteinID:  WJZ77008 LinkDB All DBs Position 1:842167..842418 Genome browser AA seq 83 aa AA seqDB search MTDTEILERIRAIFKENFAIEPERVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIVAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacaccgagatccttgagcgcatccgcgccatcttcaaagaaaacttcgcaatc gagcccgagcgcgtgacgcccgaagcgcacctgttcgaagagctcgatctggacagcatc gacgccgtcgatctcgcgatcaagctgcaggagatgacgggccgccggatcaagccggag gagttcaagtcggtgcgcacggtcggcgacgtgatcgttgccgtcgaatcgctgctcgcg gcgcagggctga

DBGET integrated database retrieval system