Paraburkholderia sabiae: QEN71_29490 Help Entry QEN71_29490       CDS       T09203                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism psaa  Paraburkholderia sabiae Brite KEGG Orthology (KO) [BR:psaa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:psaa03032]     QEN71_29490    03036 Chromosome and associated proteins [BR:psaa03036]     QEN71_29490    03400 DNA repair and recombination proteins [BR:psaa03400]     QEN71_29490 DNA replication proteins [BR:psaa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QEN71_29490 Chromosome and associated proteins [BR:psaa03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QEN71_29490 DNA repair and recombination proteins [BR:psaa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QEN71_29490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 Motif Other DBs NCBI-ProteinID:  WJZ74208 LinkDB All DBs Position 1:6547673..6547951 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKAVAKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcaggtcagacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgcttgaagttatcaagaaggctgtggcgaagggtgat gcagtccagttgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagacgggcgaaaccatcaagattccggccgcaaagaccgtcaagttcacg gctggcaaggcgttcaaggacgcagtcaacaagcgctaa

DBGET integrated database retrieval system