Paenibacillus sabinae: PSAB_05560 Help Entry PSAB_05560        CDS       T03064                                  Name (GenBank) hypothetical protein   KO K06440   similar to spore coat protein Organism psab  Paenibacillus sabinae Brite KEGG Orthology (KO) [BR:psab00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     PSAB_05560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF3854 Motif Other DBs NCBI-ProteinID:  AHV96048 UniProt:  X4ZUP2 LinkDB All DBs Position complement(1266284..1266529) Genome browser AA seq 81 aa AA seqDB search MTTQILAPHESMELHEALNFKTLCLAKSKLMQGIVFDQELKDLMQKDVEQSIQAIAELQA VYARAPFQAPVPTNRPTPILN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgactacacaaattctggcgccgcatgaatcgatggagcttcacgaagcgcttaatttt aaaacgctctgcttggccaaatccaagcttatgcagggaatcgtgtttgatcaggagctc aaagacttgatgcaaaaagatgtcgagcagtccatccaggcaattgcggagctgcaggcc gtctatgccagagctcctttccaggcgcccgtccccaccaatcgtcccacgcccattcta aactag

DBGET integrated database retrieval system