Paracoccus sanguinis: HGN31_01360 Help Entry HGN31_01360       CDS       T07521                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psan  Paracoccus sanguinis Pathway psan01100   Metabolic pathways psan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HGN31_01360    00074 Mycolic acid biosynthesis     HGN31_01360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HGN31_01360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QJD15695 LinkDB All DBs Position complement(298759..299025) Genome browser AA seq 88 aa AA seqDB search MTQDTVRDRIIAIIAEQAMLDPSEITLEATPADLGIDSLGLVESIFAIEEAFDISIPFNA NEPEKSEFDISNMGAIIAAVEALVAAKA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacccaagacaccgtccgcgaccgcatcatcgccatcatcgccgagcaggcgatgctc gacccgtccgagatcaccctcgaggcgaccccggccgacctcgggatcgacagcctcggg ctcgtcgagtcgatcttcgccatcgaggaggcgttcgacatctcgatccccttcaacgcc aacgagcccgagaagtccgagttcgatatctcgaacatgggcgcgatcatcgccgcggtc gaggcgctcgtcgccgccaaggcatga

DBGET integrated database retrieval system