Pseudomonas sp. AN-1: SK095_01025 Help Entry SK095_01025       CDS       T11500                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psao  Pseudomonas sp. AN-1 Pathway psao01100   Metabolic pathways psao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SK095_01025 (acpP)    00074 Mycolic acid biosynthesis     SK095_01025 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SK095_01025 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WPP46014 LinkDB All DBs Position 231477..231716 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHGQQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcagcttggcgttaaagaa gaagaagtgaccaacagcgcttccttcgtggaagacctgggcgctgattccctggacacc gtggagctggtcatggctctcgaggaagaattcgagaccgaaatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaatgctcacggccagcagtaa

DBGET integrated database retrieval system