Pseudomonas sp. AN-1: SK095_14610 Help Entry SK095_14610       CDS       T11500                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism psao  Pseudomonas sp. AN-1 Pathway psao00190   Oxidative phosphorylation psao01100   Metabolic pathways Module psao_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:psao00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SK095_14610  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:psao00194]     SK095_14610 Photosynthesis proteins [BR:psao00194]  Photosystem and electron transport system   F-type ATPase [OT]    SK095_14610 SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WPP44492 LinkDB All DBs Position complement(3109206..3109454) Genome browser AA seq 82 aa AA seqDB search MDNLIQIVSIIAAAVAVSFGAIGPALAEGRAVAAAMDAIARQPEAAGSLSRTLFVGLAMI ETMAIYCLVVAVLLLFANPFVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggacaacctgatccagatcgtcagcatcatcgccgccgccgtcgcggtgagcttcggc gccatcggcccggcgctggccgagggccgcgcggtggctgcggcgatggacgccatcgct cgccagccggaagccgccggcagcctgtcgcgcaccctgttcgtcggcttggcgatgatc gagaccatggccatctactgcctggtggtggcggtgctgctgctgttcgccaaccccttc gtgcactga

DBGET integrated database retrieval system