KEGG   Paracoccus saliphilus: JHX88_17080
Entry
JHX88_17080       CDS       T08849                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
psap  Paracoccus saliphilus
Pathway
psap02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JHX88_17080 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psap02000]
    JHX88_17080 (phnC)
Enzymes [BR:psap01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     JHX88_17080 (phnC)
Transporters [BR:psap02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    JHX88_17080 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA_30 SMC_N TniB AAA_23 AAA_19 Mg_chelatase nSTAND1 NB-ARC DUF87 cobW PRK BALF1 MMR_HSR1 Zeta_toxin nSTAND3 AAA_15 NACHT DO-GTPase2
Other DBs
NCBI-ProteinID: WCR02558
UniProt: A0AA46A5B9
LinkDB
Position
complement(3553212..3553997)
AA seq 261 aa
MLKITDLVKRYAGGDPVLRNLDLMVEGESVVSIIGSSGAGKSTLLRCINKLVEPSSGSIV
LNGMELTALKGRKLREARRKIGMVFQGFNLVDRLTVMENVQSGRLGYISTWAAITRRYPK
EDIRRAYELMERVGIAHYADKRADELSGGERQRVGVVRALMQQPEILLADEPTASLDPKT
SEQIMQLLRALARELSLPVLINIHNVTEARQYTDRIVGMRYGRIIFDGLPSDLDEEAMER
IYSGSPAADRAVAVGEPESVA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgctcaagatcaccgatctggtcaaacgttacgcaggcggtgacccggttctcaggaat
ctcgacctgatggtggaaggcgagagcgtcgtttccatcatcggctcgtccggggccggc
aaaagcacgcttttgcgctgcatcaataagctggtcgagccaagctcgggcagcatcgtc
ctgaatggcatggaactgactgcccttaagggacgcaaattgcgcgaggctcgccgcaag
atcggcatggtgtttcagggcttcaacctcgtcgaccggctgacggtgatggagaatgtg
caatccgggcggcttggctatatctcgacctgggcggcgatcacgcgacgatatcccaaa
gaggatatccgtcgcgcttatgagctgatggaacgggttggcattgcccactatgccgac
aagcgggccgacgaactttcagggggagagcgccagcgcgtcggtgtggtgcgtgcgttg
atgcagcagcccgagatcctgctggccgatgagcctaccgcctcgctcgatcccaagacc
tcggaacagatcatgcagttgctgcgcgctctggcgcgggaactgtcgctgccggtgctt
atcaacattcataacgtgacggaagcgagacagtatacggatcgcatcgtcggcatgcgc
tatggccggatcatcttcgacggcctcccctcggatctggacgaagaggccatggagcgg
atctattcgggcagcccggctgcggacagggccgttgccgttggagagccggagagcgtc
gcatga

DBGET integrated database retrieval system