Lathyrus oleraceus (garden pea): 127075233
Help
Entry
127075233 CDS
T08598
Name
(RefSeq) single-stranded DNA-binding protein WHY1, chloroplastic-like
KO
K26559
single-stranded DNA-binding protein WHY1
Organism
psat
Lathyrus oleraceus (garden pea)
Brite
KEGG Orthology (KO) [BR:
psat00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
psat03400
]
127075233
DNA repair and recombination proteins [BR:
psat03400
]
Eukaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
Other HR factors
127075233
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Whirly
Motif
Other DBs
NCBI-GeneID:
127075233
NCBI-ProteinID:
XP_050872678
LinkDB
All DBs
Position
4:299538258..299541033
Genome browser
AA seq
270 aa
AA seq
DB search
MSHLHLQLHSQAPSLSSSSTSRFSFLKLFTNNTFSLSPTTNSLPFKPLTIRCRHSDVFET
GTNPSIPTSTPNNNPSVGALPPRVYVGHSIYKGKAALTITPRPPEFMPLDSGAYKISKDG
YVLLQFAPSVGPRQYDWNRKQVFSLSVDEMGSVISLGARDRCEFFHDPYKGKSDEGKVKK
VLKVEPFPDGSGFFFNLGVQNNLANLEESITLPVTKSELSVLSAIFKFIMPYLLGWHTFA
DSINPEYSVAAASVARNANPKYGGDYEWSR
NT seq
813 nt
NT seq
+upstream
nt +downstream
nt
atgtcgcatttgcatttacagctacactcacaagcaccgtcgctctcttcttcttcaact
tctcgtttttctttccttaagcttttcacaaacaacactttctctttatctccaacaaca
aactctcttcctttcaaacccttaactatcagatgccgccactctgacgtctttgaaact
ggaaccaacccttctattcccacttcaacccccaacaacaacccttcagttggagcttta
ccacctagggtttatgttggtcattccatttacaaggggaaggctgctctcactatcact
cctcgaccgccggagttcatgcctttggattcaggggcatataagatatctaaggatggt
tatgtgctgcttcagtttgccccatcggttggtccgcgccagtatgattggaatagaaaa
caggttttctcgttatcggtggatgaaatgggaagtgtgattagccttggtgcaagggac
cgttgtgaattttttcatgatccttacaagggaaaaagcgatgaaggcaaagtcaaaaaa
gttttgaaagttgagccttttccggatggttctggattcttctttaatctcggtgttcaa
aacaaccttgcgaacttggaagaaagcatcactctccccgtaacaaaatcagagttatca
gttttgagcgcaattttcaagttcatcatgccgtacctacttggttggcatacctttgca
gactcgataaatccggaatattctgtggcggcggcgagtgtggcacgcaatgccaacccc
aaatatggaggagactatgaatggagcagatag
DBGET
integrated database retrieval system