Lathyrus oleraceus (garden pea): 127082065 Help Entry 127082065         CDS       T08598                                  Name (RefSeq) probable histone H2A.3   KO K11251   histone H2A Organism psat  Lathyrus oleraceus (garden pea) Pathway psat03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:psat00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127082065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psat03036]     127082065   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psat04147]     127082065 Chromosome and associated proteins [BR:psat03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127082065 Exosome [BR:psat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127082065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Cdc6_lid Motif Other DBs NCBI-GeneID:  127082065 NCBI-ProteinID:  XP_050878244 LinkDB All DBs Position 5:complement(441737385..441737896) Genome browser AA seq 97 aa AA seqDB search MLMKEYRQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEEL SKLLGDVTIADGGVMPNIHNLLLPKKAGSSKGAGDDE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgttgatgaaggagtaccggcagcgtgtcggcgctggtgctcctgtatacctcgctgcc gtcctggaatatcttgccgctgaggttcttgaattggctggaaatgctgcaagggacaac aagaagactagaattgtgccaaggcatattcaattggctgttagaaacgatgaagaactg agcaagcttcttggtgatgttaccattgccgatggcggcgtgatgcccaatattcacaac ctgttgcttccaaagaaagctggttcctctaagggtgctggtgacgatgaatga

DBGET integrated database retrieval system