Lathyrus oleraceus (garden pea): 127087275 Help Entry 127087275         CDS       T08598                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism psat  Lathyrus oleraceus (garden pea) Pathway psat03010   Ribosome psat04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:psat00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     127087275   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127087275  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:psat03011]     127087275    04121 Ubiquitin system [BR:psat04121]     127087275   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psat04147]     127087275 Ribosome [BR:psat03011]  Ribosomal proteins   Eukaryotes    Small subunit     127087275   Archaea     127087275 Ubiquitin system [BR:psat04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    127087275 Exosome [BR:psat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127087275   Exosomal proteins of colorectal cancer cells    127087275 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Plexin_RBD Ubiquitin_5 UBL_UBAC1 TBK1_ULD Rad60-SLD_2 OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  127087275 NCBI-ProteinID:  XP_050884103 LinkDB All DBs Position 5:626919899..626920841 Genome browser AA seq 86 aa AA seqDB search MQIFVKTLTGKTITLEVKSSDTIDNVKAKIQDKEGIPPDQQRLIFADKQLEDGRTLADYN IQKESTLHLVLRLRGGAEKRKKKTYT NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtcaaaaccctgacggggaaaaccatcaccctcgaggtcaagtcttcc gacaccatcgataatgtcaaagcaaagatccaagataaggaaggaatcccaccggaccaa caacgactcatcttcgccgacaaacagctagaagacggccgcactcttgctgactacaac atccagaaggaatccacactccaccttgttctccgtctccgtggtggagccgagaagcgt aagaagaagacttacacatag

DBGET integrated database retrieval system