Pisum sativum (pea): 127126535 Help Entry 127126535         CDS       T08598                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism psat  Pisum sativum (pea) Pathway psat04016   MAPK signaling pathway - plant psat04070   Phosphatidylinositol signaling system psat04075   Plant hormone signal transduction psat04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:psat00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     127126535    04070 Phosphatidylinositol signaling system     127126535    04075 Plant hormone signal transduction     127126535  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     127126535  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psat01009]     127126535   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psat04131]     127126535    03036 Chromosome and associated proteins [BR:psat03036]     127126535   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psat04147]     127126535 Protein phosphatases and associated proteins [BR:psat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127126535 Membrane trafficking [BR:psat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127126535 Chromosome and associated proteins [BR:psat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127126535 Exosome [BR:psat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127126535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 Dockerin_1 DUF5580_M EFhand_Ca_insen Caleosin FCaBP_EF-hand MotA_activ PA_Ig-like SPEF2_C SurA_N_3 MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  127126535 NCBI-ProteinID:  XP_050911433 LinkDB All DBs Position 3:233954224..233955509 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagatcaactcacagatgatcagatctctgaattcaaggaagccttcagcttgttt gataaagatggcgatggttccatcacaacaaaggagcttggaactgtgatgaggtcatta ggccaaaatccaacagaggcagagctacaagacatgataaacgaggtcgatgctgatggt aacggaacaatcgatttccctgaatttctaaaccttatggcaaggaaaatgaaagacaca gattcagaggaggagctgaaagaagcattcagagtattcgataaggatcagaacggattc atttctgctgccgaacttcgtcatgtaatgaccaatcttggcgagaagctaactgatgaa gaagtcgatgagatgattcgagaggctgatgttgatggcgatggtcaaattaattatgat gaatttgttaaggttatgatggccaagtga

DBGET integrated database retrieval system