Pseudomonas syringae pv. syringae B728a: Psyr_0437 Help Entry Psyr_0437         CDS       T00246                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism psb  Pseudomonas syringae pv. syringae B728a Pathway psb00998   Biosynthesis of various antibiotics psb01100   Metabolic pathways psb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psyr_0437    00074 Mycolic acid biosynthesis     Psyr_0437   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psyr_0437 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAY35507 UniProt:  Q4ZZB5 LinkDB All DBs Position complement(475287..475547) Genome browser AA seq 86 aa AA seqDB search MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDALELGLAIQKRYGIRID ADAKDTRNHFASVDSLAAFVSARQPA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggacattaaattgttgatcatcgatgccctgggcctcgaagac atcaccccggaagatatcggcaacgatatgacgctgtttggcgaaggactgggactggac tcggtggatgcactcgaattgggcctggccatccagaagcgttatggcatcaggatcgat gccgatgcaaaggacacccgtaaccatttcgccagcgtcgacagccttgcggccttcgtc agcgccagacaaccggcctga

DBGET integrated database retrieval system