Pseudomonas syringae pv. syringae B728a: Psyr_0572 Help Entry Psyr_0572         CDS       T00246                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psb  Pseudomonas syringae pv. syringae B728a Pathway psb02024   Quorum sensing psb03018   RNA degradation Brite KEGG Orthology (KO) [BR:psb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Psyr_0572  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Psyr_0572  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psb03019]     Psyr_0572    03036 Chromosome and associated proteins [BR:psb03036]     Psyr_0572 Messenger RNA biogenesis [BR:psb03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Psyr_0572 Chromosome and associated proteins [BR:psb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Psyr_0572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AAY35642 UniProt:  Q4ZYY0 LinkDB All DBs Position 650619..650879 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSATDADGADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaataccttgcgtaaagagaaggtc ggggtatcgatctatctggtcaacggtatcaagctgcagggtacgatcgagtctttcgac cagttcgtcattttgctgaagaacacggtcagccagatggtctacaaacacgccatttcc accgtcgtaccggttcgtccgatccgcctgccaagcgctacagacgctgacggcgcggac gccgagccaggtaacgcctga

DBGET integrated database retrieval system