Pseudomonas syringae pv. syringae B728a: Psyr_1648 Help Entry Psyr_1648         CDS       T00246                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism psb  Pseudomonas syringae pv. syringae B728a Pathway psb00998   Biosynthesis of various antibiotics psb01100   Metabolic pathways psb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psyr_1648    00074 Mycolic acid biosynthesis     Psyr_1648   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psyr_1648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AAY36696 UniProt:  Q4ZVX6 LinkDB All DBs Position 1853448..1853690 Genome browser AA seq 80 aa AA seqDB search MSTTSIEERVKKIVAEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDE EAEKITTVQAAIDYVTSHQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaccacatccatcgaagagcgcgtcaagaaaatcgttgcagagcaacttggcgtc aaacaagaagaggttgtcaacactgcttctttcgttgaggacctgggcgctgactccctg gacaccgtcgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaa gaagcggaaaagatcactaccgttcaagcagcaatcgactacgtcactagccatcaggct taa

DBGET integrated database retrieval system