Pseudomonas syringae pv. syringae B728a: Psyr_4073 Help Entry Psyr_4073         CDS       T00246                                  Name (GenBank) Chaperonin Cpn10   KO K04078   chaperonin GroES Organism psb  Pseudomonas syringae pv. syringae B728a Brite KEGG Orthology (KO) [BR:psb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psb03110]     Psyr_4073    03029 Mitochondrial biogenesis [BR:psb03029]     Psyr_4073 Chaperones and folding catalysts [BR:psb03110]  Heat shock proteins   HSP10    Psyr_4073 Mitochondrial biogenesis [BR:psb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Psyr_4073 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AAY39103 UniProt:  Q4ZP19 LinkDB All DBs Position complement(4857219..4857512) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEIVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtcgtcatccgtcgcagtgaagaagaaacgaaa actgccggcggtatcgttctgccaggttcggctgctgaaaagcctaaccgcggcgagatc gttgctgtgggtaccggccgcgtgctggacaacggcgaagtacgtgcgctggctgtgaaa gtgggtgacaaggttgtgttcggcccttattccggcagcaacacagtgaaagtagacggc gaagacctgctggtgatgagcgagaacgagattcttgctgtcgtcgaaggctga

DBGET integrated database retrieval system