Stutzerimonas stutzeri CCUG 29243: A458_06500 Help Entry A458_06500        CDS       T02168                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism psc  Stutzerimonas stutzeri CCUG 29243 Pathway psc00362   Benzoate degradation psc00621   Dioxin degradation psc00622   Xylene degradation psc01100   Metabolic pathways psc01120   Microbial metabolism in diverse environments psc01220   Degradation of aromatic compounds Module psc_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:psc00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A458_06500    00622 Xylene degradation     A458_06500    00621 Dioxin degradation     A458_06500 Enzymes [BR:psc01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      A458_06500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI Motif Other DBs NCBI-ProteinID:  AFM32546 UniProt:  I4CR39 LinkDB All DBs Position complement(1432223..1432414) Genome browser AA seq 63 aa AA seqDB search MPIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMPKVHFGIGGESAKA IGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgcctattgcccagatccacatccttgaaggccgcagcgacgagcagaaggaaaccctc attcgcgaagtcagcgaggccatctcgcgctccctggatgcgccgctgaccagcgtgcga gtgatcatcaccgagatgcccaaggtccacttcggcatcggcggcgagagcgccaaggcc attggtcgatga

DBGET integrated database retrieval system