Stutzerimonas stutzeri CCUG 29243: A458_07870 Help Entry A458_07870        CDS       T02168                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psc  Stutzerimonas stutzeri CCUG 29243 Pathway psc01100   Metabolic pathways psc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A458_07870    00074 Mycolic acid biosynthesis     A458_07870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A458_07870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFM32820 UniProt:  I4CRW3 LinkDB All DBs Position complement(1700596..1700844) Genome browser AA seq 82 aa AA seqDB search MNEKEILQALTQVFQDVFDDDDIVLTSETTADDIDGWDSQTHVLLIVAAEQRFGIKFRTA ELESLKNVGHFAQLIQTKLGGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaaaggaaattctccaggcgctgacccaggtcttccaagacgtgttcgacgat gacgatatcgtcctcacctccgaaaccaccgccgacgacatcgatggctgggacagccag acccatgtgctgctgatcgtggccgccgagcaacgcttcggcatcaagttccgcaccgcc gaactggaatcactgaagaacgttggccacttcgcgcaactgatccagaccaaactcgga gggcgttga

DBGET integrated database retrieval system