Stutzerimonas stutzeri CCUG 29243: A458_13860 Help Entry A458_13860        CDS       T02168                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psc  Stutzerimonas stutzeri CCUG 29243 Pathway psc01100   Metabolic pathways psc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A458_13860 (acpP)    00074 Mycolic acid biosynthesis     A458_13860 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A458_13860 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AFM34003 UniProt:  I4CV96 LinkDB All DBs Position complement(3027652..3027888) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaagct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system