Pseudoalteromonas sp. CF6-2: L3Q70_09245 Help Entry L3Q70_09245       CDS       T11185                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pscf  Pseudoalteromonas sp. CF6-2 Pathway pscf01100   Metabolic pathways pscf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pscf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L3Q70_09245 (acpP)    00074 Mycolic acid biosynthesis     L3Q70_09245 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L3Q70_09245 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Motif Other DBs NCBI-ProteinID:  UJX24225 LinkDB All DBs Position complement(1995780..1996016) Genome browser AA seq 78 aa AA seqDB search MSDIQERVKKIIIEQLGVKEEEVKHEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTAHAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatccaagaacgcgtaaagaaaattatcattgagcaactaggtgttaaagaa gaagaagtaaaacatgaagcttctttcgtagatgacttaggtgctgattcacttgatact gtagaactagtaatggctcttgaagaagagttcgacactgagatcccagacgaagaagct gaaaagatcactacagttcaagctgcaatcgattacgttacagctcacgctgagtaa

DBGET integrated database retrieval system