Pseudoalteromonas sp. CF6-2: L3Q70_10245 Help Entry L3Q70_10245       CDS       T11185                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pscf  Pseudoalteromonas sp. CF6-2 Brite KEGG Orthology (KO) [BR:pscf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pscf03036]     L3Q70_10245    03400 DNA repair and recombination proteins [BR:pscf03400]     L3Q70_10245 Chromosome and associated proteins [BR:pscf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     L3Q70_10245 DNA repair and recombination proteins [BR:pscf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       L3Q70_10245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N DUF4355 GIDA_C_1st ThiS Mst1_SARAH FF_PRPF40A HTH_3 VIT1 Motif Other DBs NCBI-ProteinID:  UJX24403 LinkDB All DBs Position complement(2211345..2211650) Genome browser AA seq 101 aa AA seqDB search MKEIRSFVKTASLSELEKAKQLIDTAIEKNTQQQEAKKEVLDLLKEKGLTLEDLQDVVGT DKRTKVKPKYRIEYNGEIVEWTGRGKRPKAFQGVDLTKHLA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaagaaattcgatcttttgtaaaaactgcatctttaagtgagctagaaaaagcaaag caacttattgatacagctatcgagaaaaatactcaacagcaagaagctaaaaaagaagta ctcgatcttttaaaagaaaaaggacttacattagaagatctacaagatgtggtaggcact gataagcgcacaaaagtaaaacctaaataccgcattgagtataatggtgaaatcgttgag tggactggccgtggtaaacgacctaaagcattccaaggcgttgatttaactaaacaccta gcataa

DBGET integrated database retrieval system